PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10016017m
Common NameCICLE_v10016017mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Dof
Protein Properties Length: 312aa    MW: 33970.8 Da    PI: 9.3835
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10016017mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.42.3e-3648105259
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                      + + lkcprCdstntkfCyynny+ sqPr+fCkaC+r+WtkGG+lrnvP+Gggr+ ++
  Ciclev10016017m  48 QAEPLKCPRCDSTNTKFCYYNNYNKSQPRHFCKACKRHWTKGGTLRNVPIGGGRKSKR 105
                      56789************************************************87766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2349105IPR003851Zinc finger, Dof-type
PfamPF027017.6E-3251104IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.36352106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MGLSSKQVSS DGQGWSQSLL QAQTLELPKP ASVKRPLQQQ SSLNQQQQAE PLKCPRCDST  60
NTKFCYYNNY NKSQPRHFCK ACKRHWTKGG TLRNVPIGGG RKSKRLKTSD NAATSTATAT  120
ASRVSTHVAV QSQQQRQILP FPLGDDQKNL SDVPLYQPLI HPPSNLLESK GMGTNNINVG  180
NPFISSSLGL PQIQIQKYQS LTIPNHASTS SFNPTPSTVS NSFQRSASVI NYAGEITMED  240
PTNVISTTST TATSMPITIA SSSAVTQPWQ QVASTSSGTN NMTTSYWNWD DIDTFVSTDL  300
NIPWDDSDIK P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449294.10.0hypothetical protein CICLE_v10016017mg
TrEMBLV4W8I60.0V4W8I6_9R
STRINGPOPTR_0004s03900.11e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12692896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-29Dof family protein